Ekonomiktasimacilik.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Adana Evden Eve Nakliyat ve Taşımacılık Fiyatları |
| Description | Adana Evden Eve Nakliyat ve Taşımacılık Firması Ekonomik Taşımacılık 27 Ocak Fiyatları. |
| Keywords | taşımacılık, nakliyat, nakliye, ücret, adana, ev, evden eve, fiyat, ekonomik, firma |
Server Information
| WebSite | |
| Host IP | 185.48.182.108 |
| Location | Turkey |
Related Websites
| Site | Rank |
| adanaevdenevenakliyati.net | #6,929,244 |
| hilalkargo.com | #6,473,836 |
| seyhankargo.com | #3,526,378 |
| adanatrans.com | #3,683,161 |
| adanaevdenevenakliyatfirmalari.com | #4,629,493 |
More to Explore
Ekonomiktasimacilik.com Valuation
|
US$7,760
Last updated: Jan 27, 2020
Ekonomiktasimacilik.com has global traffic rank of 4,367,497. Ekonomiktasimacilik.com has an estimated worth of US$ 7,760, based on its estimated Ads revenue. Ekonomiktasimacilik.com receives approximately 708 unique visitors each day. Its web server is located in Turkey, with IP address 185.48.182.108. According to SiteAdvisor, ekonomiktasimacilik.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$7,760 |
| Daily Ads Revenue | US$4 |
| Monthly Ads Revenue | US$127 |
| Yearly Ads Revenue | US$1,552 |
| Daily Unique Visitors | 708 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 4,367,497 |
| Delta (90 Days) | 0 |
| Most Popular In Country | N/A |
| Country Rank | N/A |
DNS Records
| Host | Type | TTL | Data |
| ekonomiktasimacilik.com | A | 14399 | IP: 185.48.182.108 |
| ekonomiktasimacilik.com | MX | 14399 | Priority: 0 Target: ekonomiktasimacilik.com. |
| ekonomiktasimacilik.com | NS | 21599 | Target: ns1.ekonomiktasimacilik.com. |
| ekonomiktasimacilik.com | NS | 21599 | Target: ns2.ekonomiktasimacilik.com. |
| ekonomiktasimacilik.com | SOA | 21599 | MNAME: ns1.ekonomiktasimacilik.com. RNAME: skynettebilgisayar.gmail.com. Serial: 2017060203 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
HTTP Headers
HTTP/1.1 200 OK Date: Mon, 27 Jan 2020 16:08:59 GMT Server: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: PHP/5.4.29 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=57c90a8c0e904d018bb54e47ec8d3c64; path=/ Transfer-Encoding: chunked Content-Type: text/html |
Ekonomiktasimacilik.com Whois Information
Domain Name: EKONOMIKTASIMACILIK.COM Registry Domain ID: 1263000845_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.nicproxy.com Registrar URL: http://https://nicproxy.com/ Updated Date: 2019-10-04T08:32:29Z Creation Date: 2007-10-08T12:54:30Z Registry Expiry Date: 2020-10-08T12:54:30Z Registrar: Nics Telekomunikasyon A.S. Registrar IANA ID: 1454 Registrar Abuse Contact Email: abuse@nicproxy.com Registrar Abuse Contact Phone: +90 212 213 2963 Domain Status: ok https://icann.org/epp#ok Name Server: NS1.EKONOMIKTASIMACILIK.COM Name Server: NS2.EKONOMIKTASIMACILIK.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ Domain Name: EKONOMIKTASIMACILIK.COM Registry Domain ID : 1263000845_DOMAIN_COM-VRSN Registrar WHOIS Server : whois.nicproxy.com Registrar URL: http://www.nicproxy.com Updated Date: 2019-10-04T08:30:01Z Creation Date: 2007-10-08T12:54:30Z Registrar Registration Expiration Date: 2020-10-08T12:54:30Z Registrar: NICS Telekomunikasyon A.S. Registrar IANA ID: 1454 Registrar Abuse Contact Email: abuse@nicproxy.com Registrar Abuse Contact Phone: +90.2122132963 Reseller: CIZGI TELEKOMUNIKASYON A.S Domain Status: ok http://www.icann.org/epp#OK Registrant Organization: Murat Sen Registrant State / Province: Cukurova Registrant Country: TR Name Server: NS1.EKONOMIKTASIMACILIK.COM Name Server: NS2.EKONOMIKTASIMACILIK.COM DNSSEC: Unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ NICProxy Whois Server Ver.1.1.2 |